General Information

  • ID:  hor000820
  • Uniprot ID:  Q5W1L4
  • Protein name:  Corazonin precursor-related peptide
  • Gene name:  Crz
  • Organism:  Drosophila erecta (Fruit fly)
  • Family:  Corazonin family
  • Source:  animal
  • Expression:  Expression is restricted to 24 neurons in the larval CNS (8 in the brain and 16 in the ventral nerve cord) and 12-16 neurons in the pars lateralis of the adult brain.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  melanogaster subgroup, melanogaster group, Sophophora (subgenus), Drosophila (genus), Drosophilini (tribe), Drosophilinae (subfamily), Drosophilidae (family), Ephydroidea (superfamily), Acalyptratae, Schizophora, Cyclorrhapha, Eremoneura, Muscomorpha (infraorder), Brachycera (suborder), Diptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005184 neuropeptide hormone activity; GO:0071858 corazonin receptor binding
  • GO BP:  GO:0006117 acetaldehyde metabolic process; GO:0007218 neuropeptide signaling pathway; GO:0007619 courtship behavior; GO:0045823 positive regulation of heart contraction; GO:0048149 behavioral response to ethanol; GO:0071361 cellular response to ethanol
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  SFNAASPLLTTGHLHRGSELGLSDLYDLQEWTSD
  • Length:  34(34-67)
  • Propeptide:  MLRLLLLPLFLFTLSMCMGQTFQYSRGWTNGKRSFNAASPLLTTGHLHRGSELGLSDLYDLQEWTSDRRLERCLSQLQRSLIARNCVPGSDFNANRVDPDPESSAHPRLGNINNENVLYSSANVPTRHRQSNELLEELSAAGGASAEPNVFGKH
  • Signal peptide:  MLRLLLLPLFLFTLSMCMG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Be involved in the physiological regulation of the heart beat
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q5W1L4-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor000820_AF2.pdbhor000820_ESM.pdb

Physical Information

Mass: 432084 Formula: C164H248N44O56
Absent amino acids: CIKMV Common amino acids: L
pI: 4.23 Basic residues: 3
Polar residues: 13 Hydrophobic residues: 11
Hydrophobicity: -39.71 Boman Index: -5486
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 86.18
Instability Index: 3667.65 Extinction Coefficient cystines: 6990
Absorbance 280nm: 211.82

Literature

  • PubMed ID:  NA
  • Title:  NA